DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and ERV15

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_009769.1 Gene:ERV15 / 852511 SGDID:S000000414 Length:142 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:43/139 - (30%)
Similarity:78/139 - (56%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ITLLVYGAILLLL-----IYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGH 70
            ::|.|.|.||..|     ||:.:...|||.||:|:.|.|:|:|...:|:....|.:..|.|..|:
Yeast     6 LSLFVTGLILNCLNSICQIYFTILYGDLEADYINSIELCKRVNRLSVPEAILQAFISALFLFNGY 70

  Fly    71 WVMFLLNLPMVIWLFYELHRQRRDSLGVYDPVDIHSR-GLLKVHLRNCMIYLGYYFVMFFVGLYC 134
            |.:||||:|::.:...:::::..    :.|..||..: |..|:   .|.:.||:|.::||...|.
Yeast    71 WFVFLLNVPVLAYNASKVYKKTH----LLDATDIFRKLGRCKI---ECFLKLGFYLLIFFFYFYR 128

  Fly   135 LISSLIKGD 143
            ::::|::.|
Yeast   129 MVTALLEND 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 40/127 (31%)
ERV15NP_009769.1 Cornichon 8..120 CDD:397410 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59615
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.