DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and AT1G12390

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_172701.2 Gene:AT1G12390 / 837794 AraportID:AT1G12390 Length:137 Species:Arabidopsis thaliana


Alignment Length:147 Identity:47/147 - (31%)
Similarity:75/147 - (51%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TFCITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGHWV 72
            |:.|:.....|::.:::|.::.|||||.||:|..:...|:|..|:|:|....:|||..||.|||.
plant     6 TWLISFFFLIALVGIIVYQLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLCVFYLLTGHWF 70

  Fly    73 MFLLNLPMVIWLFYELH----RQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLY 133
            |.||.||   :|:|..|    ||.     :.|..:|.:  ||....:..:..|.|..:..|:.::
plant    71 MTLLCLP---YLYYNFHLYSKRQH-----LVDVTEIFN--LLNWEKKKRLFKLAYIVLNLFLTIF 125

  Fly   134 CLISSLIKGDPIKRYED 150
            .:|.|.:..     |||
plant   126 WMIYSALDD-----YED 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 42/128 (33%)
AT1G12390NP_172701.2 Cornichon 5..125 CDD:397410 42/128 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3430
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2426
OMA 1 1.010 - - QHG59615
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.