DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and AT4G12090

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_192946.2 Gene:AT4G12090 / 826817 AraportID:AT4G12090 Length:135 Species:Arabidopsis thaliana


Alignment Length:134 Identity:43/134 - (32%)
Similarity:73/134 - (54%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGHWVMFL 75
            |:.|....:::::||.:..|||||.|.:|..:...|:|..|:|:||...|||:..:|.|||.|.:
plant     9 ISFLFLATLIIIVIYQLTCLADLEFDRINPYDVSSRINRMVLPEFGLQGLLCLYYILTGHWFMAV 73

  Fly    76 LNLPMVIWLFYELH-RQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYCLISSL 139
            |:||   .|||.:. ..:|:.|.  |..::::..  |...:..:..:|:..:..|:..|.||.|.
plant    74 LSLP---HLFYNIRLYMKREHLA--DVTELYNTN--KWEQKKRVYKIGHIALSIFITTYWLIHSA 131

  Fly   140 IKGD 143
            : ||
plant   132 L-GD 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 37/122 (30%)
AT4G12090NP_192946.2 Cornichon 7..125 CDD:367442 37/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3430
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2426
OMA 1 1.010 - - QHG59615
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.