DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and Cnih3

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001160050.1 Gene:Cnih3 / 690252 RGDID:1582859 Length:160 Species:Rattus norvegicus


Alignment Length:153 Identity:38/153 - (24%)
Similarity:71/153 - (46%) Gaps:19/153 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATFC--ITLLVYGAILLLLIYYVLTLADLECDY----------------LNAQECCRRLNFWVIP 53
            |.||  ::|::..|::...|::::...:|..|:                .|.:..|..|...|:|
  Rat     6 AAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLP 70

  Fly    54 KFGSHALLCVLLLLGGHWVMFLLNLPMVIWLFYELHRQRRDSLGV-YDPVDIHSRGLLKVHLRNC 117
            ::..|:|.||:.|....|:...||:|::.:.|:.......||..: |||..:.:...|....:..
  Rat    71 EYSIHSLFCVMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEA 135

  Fly   118 MIYLGYYFVMFFVGLYCLISSLI 140
            ...|.:|.:.||..|||:|.:|:
  Rat   136 WCKLAFYLLSFFYYLYCMIYTLV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 32/143 (22%)
Cnih3NP_001160050.1 Cornichon 7..151 CDD:308754 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.