DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and cnih3

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_021324333.1 Gene:cnih3 / 564015 ZFINID:ZDB-GENE-041001-180 Length:178 Species:Danio rerio


Alignment Length:176 Identity:41/176 - (23%)
Similarity:76/176 - (43%) Gaps:46/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATFC--ITLLVYGAILLLLIYYVLTLADLECDY---------LNAQE--------CC--RRLNFW 50
            |.||  ::|::..:::...|:::....:|:.|:         |:|:|        ||  |:.| |
Zfish     5 AAFCYMLSLVLCASLIFFAIWHITAFDELQADFKVPIDQGNPLHARERLRNIERICCLLRKQN-W 68

  Fly    51 ----------------VIPKFGSHALLCVLLLLGGHWVMFLLNLPMVIWLFYE-----LHRQRRD 94
                            |:|::..|.|.|::.|....|:...||:|:   |||.     .|.....
Zfish    69 HSAVAKNCPVLPQLKLVLPEYSIHVLFCIMFLCAQEWLTVGLNIPL---LFYNTWSRYFHSPTDT 130

  Fly    95 SLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYCLISSLI 140
            ...:|||..:.:...||...:.....:.::.:.||..|||:|.:|:
Zfish   131 KELLYDPASVMNGDTLKFCQKEAWCKMSFFVLSFFYYLYCMIYTLV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 35/166 (21%)
cnih3XP_021324333.1 Cornichon 6..169 CDD:308754 35/166 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.