DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and cnih2

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001013542.1 Gene:cnih2 / 541397 ZFINID:ZDB-GENE-050320-96 Length:160 Species:Danio rerio


Alignment Length:155 Identity:42/155 - (27%)
Similarity:76/155 - (49%) Gaps:23/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATFC--ITLLVYGAILLLLIYYVLTLADLECDY----------------LNAQECCRRLNFWVIP 53
            |.||  :||::..|::..:|:.::...:|..|:                ||.:..|..|...|:|
Zfish     6 AAFCYMLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERICNLLRRLVVP 70

  Fly    54 KFGSHALLCVLLLLGGHWVMFLLNLPMV---IWLFYELHRQRRDSLGVYDPVDIHSRGLLKVHLR 115
            ::..|.|.|::.:..|.||...||:|::   :|.|:  ||....|..:||||.:.:..:|....:
Zfish    71 EYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFF--HRPADGSEVMYDPVSVMNADILNYCQK 133

  Fly   116 NCMIYLGYYFVMFFVGLYCLISSLI 140
            .....||:|.:.||..||.::.:|:
Zfish   134 ESWCKLGFYLLSFFYYLYSMVYALV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 38/145 (26%)
cnih2NP_001013542.1 Cornichon 7..151 CDD:397410 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.