DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and cnih1

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001028278.1 Gene:cnih1 / 406282 ZFINID:ZDB-GENE-040426-1944 Length:144 Species:Danio rerio


Alignment Length:139 Identity:40/139 - (28%)
Similarity:69/139 - (49%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATFC--ITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGG 69
            |.||  :.||:..|::...|::::...:|:.||.|..:.|..||..|:|::..|...||:.|...
Zfish     6 AAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHVFFCVMFLCAA 70

  Fly    70 HWVMFLLNLPMV---IWLFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVG 131
            .|:...||:|::   ||.:  :........|:|||..|.:..:|....:.....|.:|.:.||..
Zfish    71 EWLTLGLNVPLLAYHIWRY--MSHPIMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLSFFYY 133

  Fly   132 LYCLISSLI 140
            ||.:|..|:
Zfish   134 LYGMIYVLV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 35/129 (27%)
cnih1NP_001028278.1 Cornichon 7..135 CDD:281325 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.