DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and cni

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster


Alignment Length:136 Identity:39/136 - (28%)
Similarity:68/136 - (50%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TFCITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGHWV 72
            |:.:.|:....::...|::|:...:|:.||.|..:.|..||..|:|::..|..|.:|.|..|.|.
  Fly     9 TYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWF 73

  Fly    73 MFLLNLPMV---IWLFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYC 134
            ...:|:|::   ||.:  .:|......|:|||..:.....|..::|...|.|..|.:.||..:|.
  Fly    74 SLCINIPLIAYHIWRY--KNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYG 136

  Fly   135 LISSLI 140
            ::.|||
  Fly   137 MVYSLI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 35/127 (28%)
cniNP_001260495.1 Cornichon 7..135 CDD:281325 35/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - P PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
98.780

Return to query results.
Submit another query.