DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and CNIH4

DIOPT Version :10

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_054903.1 Gene:CNIH4 / 29097 HGNCID:25013 Length:139 Species:Homo sapiens


Alignment Length:136 Identity:62/136 - (45%)
Similarity:92/136 - (67%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETATFCITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGG 69
            |...|..:||...|::.|.:|:::||:||||||:||:.||.:||.||||:...|.::.||||:..
Human     2 EAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSL 66

  Fly    70 HWVMFLLNLPMVIWLFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYC 134
            ||.:||||||:..|..|........::||:||.:||:||.||.|::..||.||::.:.||:.||.
Human    67 HWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYS 131

  Fly   135 LISSLI 140
            :|.:||
Human   132 MILALI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:460883 56/124 (45%)
CNIH4NP_054903.1 Cornichon 3..130 CDD:460883 56/126 (44%)

Return to query results.
Submit another query.