DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and erv14

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_594657.2 Gene:erv14 / 2543081 PomBaseID:SPAC30C2.05 Length:137 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:50/133 - (37%)
Similarity:81/133 - (60%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGHWVMFLLN 77
            ||:.||.:||.|:.|:..:|||.||:|..:.|.:||..|:|:..||.|:.:|||||..|::||.|
pombe    13 LLLNGANMLLQIFCVIMFSDLEMDYINPIDLCNKLNDLVMPEIISHTLVTLLLLLGKKWLLFLAN 77

  Fly    78 LPMVIW----LFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYCLISS 138
            ||::::    :.::.|        :.|..:|..:  |..|.|:..|.:.:|.:|||..|||::.|
pombe    78 LPLLVFHANQVIHKTH--------ILDATEIFRQ--LGRHKRDNFIKVTFYLIMFFTLLYCMVMS 132

  Fly   139 LIK 141
            ||:
pombe   133 LIQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 44/123 (36%)
erv14NP_594657.2 Cornichon 7..127 CDD:281325 44/123 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59615
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.