DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and SPAC2C4.05

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_594508.1 Gene:SPAC2C4.05 / 2542639 PomBaseID:SPAC2C4.05 Length:134 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:42/133 - (31%)
Similarity:73/133 - (54%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGHWVMFLL 76
            :|::..|.::|.:|:.:..:||:.|::|..:..|:||::|:|:.|..|...:||||.|.|:.|||
pombe    10 SLMLTCANIMLQMYFTVMYSDLKDDFINPIDLSRKLNWYVLPEMGFQAFSALLLLLSGAWITFLL 74

  Fly    77 NLPMVIW----LFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYCLIS 137
            |:||:.|    :....|  ..||..::.  |:.||      .:.....|..:.|.|||.|:..:|
pombe    75 NVPMLAWNAKMIMSNTH--MHDSTTIFK--DVSSR------QKRSFFKLACFAVFFFVYLFLFVS 129

  Fly   138 SLI 140
            .|:
pombe   130 RLV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 39/124 (31%)
SPAC2C4.05NP_594508.1 Cornichon 4..116 CDD:281325 35/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59615
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.