DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and cor1

DIOPT Version :10

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_594508.1 Gene:cor1 / 2542639 PomBaseID:SPAC2C4.05 Length:134 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:42/133 - (31%)
Similarity:73/133 - (54%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGGHWVMFLL 76
            :|::..|.::|.:|:.:..:||:.|::|..:..|:||::|:|:.|..|...:||||.|.|:.|||
pombe    10 SLMLTCANIMLQMYFTVMYSDLKDDFINPIDLSRKLNWYVLPEMGFQAFSALLLLLSGAWITFLL 74

  Fly    77 NLPMVIW----LFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYCLIS 137
            |:||:.|    :....|  ..||..::.  |:.||      .:.....|..:.|.|||.|:..:|
pombe    75 NVPMLAWNAKMIMSNTH--MHDSTTIFK--DVSSR------QKRSFFKLACFAVFFFVYLFLFVS 129

  Fly   138 SLI 140
            .|:
pombe   130 RLV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:460883 39/124 (31%)
cor1NP_594508.1 Cornichon 4..116 CDD:460883 35/115 (30%)

Return to query results.
Submit another query.