DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and CNIH3

DIOPT Version :10

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001309231.1 Gene:CNIH3 / 149111 HGNCID:26802 Length:188 Species:Homo sapiens


Alignment Length:115 Identity:31/115 - (26%)
Similarity:57/115 - (49%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ECDYLNAQE-------CCRRLNFWVIPKFGSHALLCVLLLLGGHWVMFLLNLPMVIWLFYELHRQ 91
            :|:.::|:|       .|..|...|:|::..|:|.|::.|....|:...||:|::.:.|:.....
Human    72 QCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHC 136

  Fly    92 RRDSLGV-YDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYCLISSLI 140
            ..||..: |||..:.:...|....:.....|.:|.:.||..|||:|.:|:
Human   137 PADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:460883 26/106 (25%)
CNIH3NP_001309231.1 Cornichon 56..179 CDD:460883 26/106 (25%)

Return to query results.
Submit another query.