DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and Cnih2

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_034050.1 Gene:Cnih2 / 12794 MGIID:1277225 Length:160 Species:Mus musculus


Alignment Length:159 Identity:45/159 - (28%)
Similarity:77/159 - (48%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATFC--ITLLVYGAILLLLIYYVLTLADLECDYLN---------AQE--------CC--RRLNFW 50
            |.||  :||::..:::..:|::::...:|..|:.|         |:|        ||  |:|   
Mouse     6 AAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKL--- 67

  Fly    51 VIPKFGSHALLCVLLLLGGHWVMFLLNLPMVIWLFYEL----HRQRRDSLGVYDPVDIHSRGLLK 111
            |:|::..|.|.|::.|....||...||:|:   |||.|    ||....|..:||.|.|.:..:|.
Mouse    68 VVPEYSIHGLFCLMFLCAAEWVTLGLNIPL---LFYHLWRYFHRPADGSEVMYDAVSIMNADILN 129

  Fly   112 VHLRNCMIYLGYYFVMFFVGLYCLISSLI 140
            ...:.....|.:|.:.||..||.::.:|:
Mouse   130 YCQKESWCKLAFYLLSFFYYLYSMVYTLV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 41/149 (28%)
Cnih2NP_034050.1 Cornichon 7..151 CDD:397410 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.