DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and cnih3

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_002939797.1 Gene:cnih3 / 100497549 XenbaseID:XB-GENE-958010 Length:160 Species:Xenopus tropicalis


Alignment Length:155 Identity:39/155 - (25%)
Similarity:73/155 - (47%) Gaps:23/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATFC--ITLLVYGAILLLLIYYVLTLADLECDYLN-AQEC---------------CRRLNFWVIP 53
            |.||  ::|::..|::...|::::...:|..|:.| ..:|               |..|...|:|
 Frog     6 AAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKNPIDQCNPAHARERLRNIERICFLLRKLVLP 70

  Fly    54 KFGSHALLCVLLLLGGHWVMFLLNLPMV---IWLFYELHRQRRDSLGVYDPVDIHSRGLLKVHLR 115
            ::..|:|.|::.|....|:...||.|::   ||.::  |.....:..:|||:.:.|...|....:
 Frog    71 EYSIHSLFCIMFLCAEEWLTLGLNAPLLFYHIWRYF--HSPADSAELIYDPLVVMSASTLSYCQK 133

  Fly   116 NCMIYLGYYFVMFFVGLYCLISSLI 140
            .....|.:|.:.||..|||:|.:|:
 Frog   134 EAWCKLAFYLLSFFYYLYCMIYTLM 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 33/145 (23%)
cnih3XP_002939797.1 Cornichon 8..151 CDD:367442 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.