powered by:
Protein Alignment GABPI and PFA5
DIOPT Version :9
Sequence 1: | NP_608741.1 |
Gene: | GABPI / 33516 |
FlyBaseID: | FBgn0031495 |
Length: | 420 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010747.1 |
Gene: | PFA5 / 852070 |
SGDID: | S000002867 |
Length: | 374 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 23/73 - (31%) |
Similarity: | 32/73 - (43%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 HGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGA 326
||.|..|..|:.:...|.:|....|.|:.|.||:..|:...||..||..::...|.....||
Yeast 125 HGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLL--- 186
Fly 327 NLTLTSIC 334
:...|||
Yeast 187 -IMWVSIC 193
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.