DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and AKR1

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_010550.1 Gene:AKR1 / 851857 SGDID:S000002672 Length:764 Species:Saccharomyces cerevisiae


Alignment Length:325 Identity:68/325 - (20%)
Similarity:115/325 - (35%) Gaps:89/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VAPAFIVPLMLGLATLNSKTAIVLMLTLVG-FTIWGMELAKRTATRTNFF--LSWLVFSVFYMII 163
            :.|.|::.::..||...:|.....:|...| ..:..:.|.:.......||  |.|:....|:.::
Yeast   344 INPLFVIIVLFLLAIATNKGLNKFVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVM 408

  Fly   164 IFEFQVPLLELAPEENYA--LMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSG 226
            ...|.        :|.|.  ||.....:::.|:.       .||....|..|             
Yeast   409 PRTFS--------DEQYTNILMLVILVSVFYLFG-------QLVIMDPGCLP------------- 445

  Fly   227 EEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNIC--EICRKVTPRRAYHCPVCGTCV 289
             |:.:.:...|..|.|.    |:|..||          .|.|  ...||  |.|:...|:....|
Yeast   446 -EETDHENVRQTISNLL----EIGKFDT----------KNFCIETWIRK--PLRSKFSPLNNAVV 493

  Fly   290 KRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCS 354
            .|.||:..|:...:|.:|:..:|..:.|.|..:     .|..::|..:.            |:..
Yeast   494 ARFDHYCPWIFNDVGLKNHKAFIFFITLMESGI-----FTFLALCLEYF------------DELE 541

  Fly   355 EVFEG--------FDLGIS------------FVVACYALLISSYIAFILARQAYLWWKGSTLHEY 399
            :..|.        |.||.|            |::..:|||.|.::|.::..||:...||.|..|:
Yeast   542 DAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEF 606

  Fly   400  399
            Yeast   607  606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 36/158 (23%)
AKR1NP_010550.1 ANK repeat 75..101 CDD:293786
ANKYR 78..270 CDD:223738
ANK repeat 103..140 CDD:293786
ANK repeat 142..173 CDD:293786
ANK repeat 213..244 CDD:293786
ANK repeat 246..271 CDD:293786
COG5273 363..725 CDD:227598 63/306 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.