DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and AT1G69420

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_177101.2 Gene:AT1G69420 / 843274 AraportID:AT1G69420 Length:596 Species:Arabidopsis thaliana


Alignment Length:343 Identity:74/343 - (21%)
Similarity:117/343 - (34%) Gaps:129/343 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 AIVLMLTLVGFTIWGMELAKRTATRTNFFLSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFS 186
            |:.:.|.| ||..:             .|.:..|....:..|......||:             :
plant    17 AVAVFLAL-GFAFY-------------VFFAPFVGKKIHQYIAMGIYTPLI-------------T 54

  Fly   187 CAA---LYCLYSAKA-----LSPLNLVSAQYGTTP--KDELPGIAEASSGEEQAEAQTTLQMESV 241
            |..   ::|..|..|     .|...|...:.|..|  ||...|...|:.|.:..:.         
plant    55 CVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLAKDIKDGCGSATGGAKSHDG--------- 110

  Fly   242 LSLDDDEVGD---MDTAERSGLMH--------------GQPN-----------ICEICRKVTPRR 278
            ..::|.|.|.   ::::|||.|:.              |:..           .|.:|.....:.
plant   111 TCVEDTENGSNKKLESSERSSLLRLLCSPCALLCSCCSGKDESSEQMSEDGMFYCSLCEVEVFKY 175

  Fly   279 AYHCPVCGTCVKRRDHHSYWLNCCIGERNY----------------VW----YIVGLAL------ 317
            :.||.||..||.|.|||..|||.|||:|||                .|    :::.|.|      
plant   176 SKHCRVCDKCVDRFDHHCRWLNNCIGKRNYRKFFSLMVSAIFLLIMQWSTGIFVLVLCLLRRNQF 240

  Fly   318 -SEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAF 381
             ::|||.||::.:|.    ||::|                     :|:..|:|..|.|..:.:.|
plant   241 NADIALKLGSSFSLI----PFVIV---------------------VGVCTVLAMLATLPLAQLFF 280

  Fly   382 ILARQAYLWWKGSTLHEY 399
            .   ...|..||.:.::|
plant   281 F---HILLIKKGISTYDY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 43/188 (23%)
AT1G69420NP_177101.2 zf-DHHC 164..296 CDD:279823 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.