DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and AT4G22750

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_567668.1 Gene:AT4G22750 / 828372 AraportID:AT4G22750 Length:302 Species:Arabidopsis thaliana


Alignment Length:297 Identity:64/297 - (21%)
Similarity:109/297 - (36%) Gaps:86/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IVLMLTLVGFTIWGMELAKRTATRTNF-----------FLSWLVFSVFYMIIIFEFQVPLLELAP 176
            |::::.::|||.:.:.:       .|:           .||.||.:.|:.::|.           
plant    20 ILIVIGIIGFTYYAVVV-------VNYGPALLIGGVDSLLSVLVLAFFHFLLIM----------- 66

  Fly   177 EENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGI-AEASSGEEQAEAQTTLQMES 240
                        .|:..:|.....|        |..|....|.: .|.|.|.:..          
plant    67 ------------LLWSYFSVVVTDP--------GGVPTGWRPELDIEKSEGNQAL---------- 101

  Fly   241 VLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGE 305
               :.:..|||..:       || ...|..|.:..|.|::||.|||.|:.:.|||..|:..|:|.
plant   102 ---IGEASVGDSSS-------HG-VRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGA 155

  Fly   306 RNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYP--VLLPDDCSEVFEGFDLGISFVV 368
            .||..:::.|..:    .|...:...|:...|:|....|..  .:.|...:..|..|.|.|:|.:
plant   156 NNYKSFLLFLFYT----FLETTVVAVSLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFAL 216

  Fly   369 ACYALLISSYIAFILARQAYLWWKGSTLHEY-KRTSN 404
            :....||...:  ::||..      :|:..| |.|.|
plant   217 SVLGFLIMHIM--LVARNT------TTIEAYEKHTVN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 37/138 (27%)
AT4G22750NP_567668.1 zf-DHHC 111..241 CDD:279823 38/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.