DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and AT3G18620

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:388 Identity:75/388 - (19%)
Similarity:124/388 - (31%) Gaps:118/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EDSRERSHILGCCCNCVDFDLVCTRLVTCRAIDRRNIDGMLIAFQDRLRLPWRGGAKRISPAAVA 103
            |||.:.|.:  ...| .|::.:|.   .|      .::.:|.::....:..|.|.....:|  |.
plant     2 EDSSQGSFV--ATIN-EDYEAICW---GC------GLNLVLPSYAPVFKCGWCGAITNQNP--VR 52

  Fly   104 PAFIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFLSWLVFSVFYMI-----I 163
            |.   ....||.....:..:|::...:.|.|.|.              .|..:.|.:.|     |
plant    53 PE---TKSFGLRRFRDRCFVVILAVFMLFVICGG--------------IWAAYPVLFSISLACGI 100

  Fly   164 IFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEE 228
            ........|.::....:.|:.|.||.          .|.|::   |||.|               
plant   101 FHSVTTATLAISTLSTFILVAFKCAG----------KPTNIL---YGTHP--------------- 137

  Fly   229 QAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPN---ICEICRKVTPRRAYHCPVCGTCVK 290
                                          |:.:|..|   .|..|.|....|.:||..||.||.
plant   138 ------------------------------GVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMCVL 172

  Fly   291 RRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSE 355
            ..|||..::..|:|..|:.::|..|..:.|:....|.:.:.::.|   ::.|:........|.:.
plant   173 DMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIH---ILPPIEKGAAYASDVAH 234

  Fly   356 VFEGFDLGISFVVACYALLISSYIAFILAR------------------QAYLWWKGSTLHEYK 400
            |..|..:.|..||....|...:...||..|                  ...||.:.|.::|.|
plant   235 VAHGNSISILRVVKNICLTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 37/157 (24%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 42/217 (19%)
DHHC 149..298 CDD:396215 37/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.