DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC11

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens


Alignment Length:76 Identity:26/76 - (34%)
Similarity:38/76 - (50%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 RRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVR 341
            ::..||..|..||...|||..|:|.|:|.||| |:.    .|.:|......|.|.:|. .:::|:
Human   191 KKTKHCISCNKCVSGFDHHCKWINNCVGSRNY-WFF----FSTVASATAGMLCLIAIL-LYVLVQ 249

  Fly   342 PLGYPVLLPDD 352
            .|..|.:|..|
Human   250 YLVNPGVLRTD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 26/76 (34%)
ZDHHC11XP_016865358.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.