DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc20

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_006519721.1 Gene:Zdhhc20 / 75965 MGIID:1923215 Length:475 Species:Mus musculus


Alignment Length:330 Identity:65/330 - (19%)
Similarity:121/330 - (36%) Gaps:98/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VLMLTLVGFTIWG-----MELAKRTATRTN------FFLSWLVFSVFYMIIIFEFQVPLLELAPE 177
            ||.:|.|  .:|.     :||...|.:||.      .:|  :.|.:|:::.::.:.:.:.     
Mouse   114 VLFITFV--VVWSYYAYVVELCVSTISRTGEKGKTVVYL--VAFHLFFVMFVWSYWMTIF----- 169

  Fly   178 ENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQ-MESV 241
                                             |:|.........::|.:|:.|.:.:.: .:.:
Mouse   170 ---------------------------------TSPASPSKEFYLSNSEKERYEKEFSQERQQDI 201

  Fly   242 LSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGER 306
            |.....::....|:....:.:     ||.|:.:.|.||:||..|..||.:.|||..|:|.|:|..
Mouse   202 LRRAARDLPIYTTSASKAIRY-----CEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFT 261

  Fly   307 NYVWYIVGLALSEIALLLGANLTLTSICHPFMVVR-------PLGYPVLL--PDDCSEVFEGFDL 362
            ||.::::.|..|.:..|..|...|......:.:.|       |...|.:|  |.....|     |
Mouse   262 NYKFFMLFLLYSLLYCLFVAATVLEYFIKFWTLCRRKSTENCPKNEPTVLNFPSAKFHV-----L 321

  Fly   363 GISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRNRIWS-------------- 413
            .:.||.|.:.:.:.|..::      :.|..|.     .||:..:.|..::|              
Mouse   322 FLFFVSAMFFVSVLSLFSY------HCWLVGK-----NRTTIESFRAPMFSYGIDGNGFSLGCSK 375

  Fly   414 NWRAI 418
            |||.:
Mouse   376 NWRQV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/145 (26%)
Zdhhc20XP_006519721.1 DHHC 111..411 CDD:388695 65/330 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.