DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc11

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:172 Identity:47/172 - (27%)
Similarity:70/172 - (40%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LDDDEVGDMDTAERSGLMHG-QPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN 307
            |..|....:...:||...|. |...|.:|.....::|.||..|..||...|||..|||.|:|.||
Mouse   105 LKKDYTQPVPAFDRSKHTHVIQNQYCHLCEVTASKKAKHCSACNKCVSGFDHHCKWLNNCVGRRN 169

  Fly   308 YVWYIVGLALSEIALLLGANLTLTSICHPFMV------VRPLGYPVLLPDDCSEVFEGF------ 360
            | |:......|....:||..:.|..||..:.|      ..|| |..::.::...:|...      
Mouse   170 Y-WFFFWSVASAAVGILGVMIILCYICIQYFVNPDELRTDPL-YKEIISENTWLLFLSLWPVPVK 232

  Fly   361 -DLGISFVVACYALLISSYI--AFILARQAYLWWKGSTLHEY 399
             .:.:|..|....|.|:|::  ..:|....||..|..:..:|
Mouse   233 TPIVLSIAVMALLLAIASFVMLGHLLIFHLYLITKNMSTFDY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 42/152 (28%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 43/154 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.