DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc12

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_079704.2 Gene:Zdhhc12 / 66220 MGIID:1913470 Length:281 Species:Mus musculus


Alignment Length:238 Identity:67/238 - (28%)
Similarity:99/238 - (41%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LNLVSAQYGTTPKDELP----GIAEASSGEEQAE----------AQTTLQMESVLSLDDDEVGDM 252
            :.||...:.|...|..|    .|.:....|||.|          ..::|.:...:||.|.  |.:
Mouse    24 ITLVLFLHDTGEPDTAPPRAHPITQLRQWEEQGELLLPLTFLLLVLSSLLLYLAVSLMDP--GYV 86

  Fly   253 DTAERSGLMHGQP--------------NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCI 303
            .|..:.   .|:|              ..|..|..:.|.||.||..|..||:|.|||..|:..|:
Mouse    87 TTQPQP---QGEPKEEQAAMVPQAVPLRRCRHCLVLQPLRARHCRDCRRCVRRYDHHCPWMENCV 148

  Fly   304 GERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVV 368
            ||||:..::..|||..:.||.|..|..:.:    ...:|.|   |.......:|..| |.:||..
Mouse   149 GERNHPLFVAYLALQLVVLLWGLCLAWSGL----QFFQPWG---LWLRSTGLLFTTF-LLLSFFA 205

  Fly   369 ACYALLISSYIAFILARQAYLW-WKGSTLHEY--KRTSNAAGR 408
            ...|||::|:: :::||....| :..|....|  :||||...|
Mouse   206 LVVALLLASHL-YLVARNTTTWEFISSHRIAYLRQRTSNPFDR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 45/151 (30%)
Zdhhc12NP_079704.2 zf-DHHC <137..231 CDD:279823 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.