DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc16

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:245 Identity:58/245 - (23%)
Similarity:85/245 - (34%) Gaps:79/245 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LRLPWRGGAKRISPAAVAPAFIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFF 150
            |||....|.:|..|         ||:.||.. ..:...|.:.:|:..:..|.:.|...|....: 
  Rat    16 LRLLLLLGYRRRCP---------PLLRGLVQ-RWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVY- 69

  Fly   151 LSWLV------FSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCL--YSAKAL------SP 201
              |||      |.|.:::::......::.:|         :.|.....|  ||...|      |.
  Rat    70 --WLVDNVIRWFGVVFVVLVIVLTGSIVAIA---------YLCVLPLILRTYSVPRLCWHFFYSH 123

  Fly   202 LNLVSA-----QYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLM 261
            .||:..     |..|||    ||....                          |..|.|..|   
  Rat   124 WNLILIVFHYYQAITTP----PGYPPQ--------------------------GRNDIATVS--- 155

  Fly   262 HGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWY 311
                 ||:.|....|.|.:||.:|..||.:.|||..|||.|:|..|:.::
  Rat   156 -----ICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 19/50 (38%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.