DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc14

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:297 Identity:68/297 - (22%)
Similarity:113/297 - (38%) Gaps:59/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 RTNFFLSWLVF-----SVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPL--- 202
            |..|:.:..:.     .|||:.::       |.|....    :||   |..|.:.|..|:|.   
Zfish    45 RNRFYCNGRIMMAKQTGVFYLTMV-------LILVTSG----LFF---AFDCPFLASNLTPAIPA 95

  Fly   203 -----------NLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGD---MD 253
                       .|:.|.:..      ||:...::.||.|:      :|..:..::...|.   ..
Zfish    96 IGGVLFVFVMGMLLRASFSD------PGVLPRATPEEAAD------IERQIDANNGPSGPGYRPP 148

  Fly   254 TAERSGLMHGQP---NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNY-VWYIVG 314
            ...|..|::||.   ..|..|:...|.||.||.:|..||.|.|||..|:..|:|.||| .:|:..
Zfish   149 PRTREVLINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFI 213

  Fly   315 LALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCS-EVFEGFDLGISFVVACYALLISSY 378
            |:||.:.:.:.|.:    |.|  :::..|...:.|..... |..:....|::|:|.....|:...
Zfish   214 LSLSFLTIFIFAFV----ITH--VILNALRKALALSTAADFEAVQKDPTGLAFLVLSKTALLDVL 272

  Fly   379 IAFILARQAYLWWKGSTLHEYKRTSNAAGRNRIWSNW 415
            ...:.....:.....|..|.|..:||......|..:|
Zfish   273 EVVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/141 (27%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 39/148 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.