DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc4

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_956343.2 Gene:zdhhc4 / 561817 ZFINID:ZDB-GENE-030131-9031 Length:345 Species:Danio rerio


Alignment Length:309 Identity:69/309 - (22%)
Similarity:107/309 - (34%) Gaps:82/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WGMELAKRTA-----TRTNFFLSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFF--------- 185
            |...:..||.     .|.||||        |:.::.|..|     ..|..|.:..|         
Zfish    50 WLQSICYRTMHRLFHQRNNFFL--------YLHLLLEVVV-----YGEFTYEVFGFCLDMGSSSL 101

  Fly   186 SCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVG 250
            |....|.|.:.|:.......|...||..|..|....:....:|:...|                 
Zfish   102 SLCVPYILLALKSCLFYLCCSRDPGTLTKSNLSAHLKIYQYDEKLFQQ----------------- 149

  Fly   251 DMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN---YVWYI 312
                    |:.      |..|:.:.|.|:.||.||..||:|.|||..|:|.|||.:|   ::.|:
Zfish   150 --------GMK------CSTCQLIKPARSKHCRVCNRCVQRFDHHCVWVNNCIGAQNTRYFMLYL 200

  Fly   313 VGLA--LSEIALL----LGANLTLTSICHPFM-----VVRPLGYPVLLPDDCSEVFE------GF 360
            :.:.  ...||:|    |...:..|.:.|...     :.:|.| |:.:.......|.      ||
Zfish   201 LSVCAMAGNIAVLTTDMLLQTVLRTGLLHAHYIDEQGIQQPAG-PLFIIQHLFLTFPRIVFMLGF 264

  Fly   361 DLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRN 409
            .:.:.|::|.|.|.   :...:|..|....|..:..|..:.....:|.|
Zfish   265 LVFVFFLLAGYCLF---HFYLVLVNQTSNEWFKAKGHNCQHCHPYSGHN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/156 (26%)
zdhhc4NP_956343.2 DHHC 152..296 CDD:396215 40/153 (26%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 342..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.