DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC7

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:305 Identity:65/305 - (21%)
Similarity:118/305 - (38%) Gaps:83/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFYMIIIFEFQVPLLELAPEEN--YAL---MFFSCAALYCLYS-----------AKAL 199
            ::||      ::...:|.|..:.|.|.::  |::   :.|:|.|:..|.|           :...
Human    53 MTWL------LVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPEKSSDC 111

  Fly   200 SPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTL------------QMESVLSLDDDEVGDM 252
            .| :..:.:.|..|  .|.||.    ||.....|:.|            .||| |.|...||   
Human   112 RP-SACTVKTGLDP--TLVGIC----GEGTESVQSLLLGAVPKGNATKEYMES-LQLKPGEV--- 165

  Fly   253 DTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN---YVWYIVG 314
                    ::..|..|  |  :.|.||:||.:|..|:::.|||..|:|.|:||:|   :|.:.:.
Human   166 --------IYKCPKCC--C--IKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMY 218

  Fly   315 LALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLP-----DDCSEVFEGFDLGISFVVACYALL 374
            :|||.:..|:        :|         |:..:..     .:||:......:.:...:....||
Human   219 IALSSVHALI--------LC---------GFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLL 266

  Fly   375 ISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRNRI-WSNWRAI 418
            ..::.|.:...|.:......|..|..::.......|: |...:::
Human   267 FFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 33/144 (23%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 34/147 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.