DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC4

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:363 Identity:82/363 - (22%)
Similarity:121/363 - (33%) Gaps:142/363 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RGGAKRISPAAVAPAFIVPLMLGLA-----TLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFF 150
            ||||:..|  .:.|..:...:.||.     |.| .|.|||.|.|.|...            |.: 
Human    35 RGGAQIFS--CIIPECLQRAVHGLLHYLFHTRN-HTFIVLHLVLQGMVY------------TEY- 83

  Fly   151 LSWLVF--------SVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSA 207
             :|.||        |:.|:::      |.|.|...    |.||:   |.|               
Human    84 -TWEVFGYCQELELSLHYLLL------PYLLLGVN----LFFFT---LTC--------------- 119

  Fly   208 QYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICR 272
              ||.     |||...::         .|....|...|:             :|..:...|..|.
Human   120 --GTN-----PGIITKAN---------ELLFLHVYEFDE-------------VMFPKNVRCSTCD 155

  Fly   273 KVTPRRAYHCPVCGT---------------CVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIAL 322
            ...|.|:.||..||:               ||.|.|||..|:|.|||..|..::::     .:..
Human   156 LRKPARSKHCSECGSRDSSGTSNSTCVCNWCVHRFDHHCVWVNNCIGAWNIRYFLI-----YVLT 215

  Fly   323 LLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLG------------------------ 363
            |..:..|:..:...|:|     :.|::.|...|.:.. |||                        
Human   216 LTASAATVAIVSTTFLV-----HLVVMSDLYQETYID-DLGHLHVMDTVFLIQYLFLTFPRIVFM 274

  Fly   364 ISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKR 401
            :.|||. .:.|:..|:.|:|    ||.....|.:|:.|
Human   275 LGFVVV-LSFLLGGYLLFVL----YLAATNQTTNEWYR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 40/175 (23%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.