DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc2

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_021336686.1 Gene:zdhhc2 / 541365 ZFINID:ZDB-GENE-050320-58 Length:374 Species:Danio rerio


Alignment Length:297 Identity:71/297 - (23%)
Similarity:124/297 - (41%) Gaps:59/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFYMIIIFEFQVPLLELAPE--EN----------YALMFFSCAALY--CLYSAKALSP 201
            |.|:......:|:.:.:...:::|..|  ||          |.|:|......|  .:|| |.::|
Zfish    15 LYWIPVLFISLIVAWSYYAYVVQLCIETIENMGEKTVYLLIYHLLFLMFVWSYWQTIYS-KPMNP 78

  Fly   202 LNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPN 266
            |.    ::..:..|:     |....|::.|:|..: :..:..       |:....|:  |.|...
Zfish    79 LK----EFHLSHVDK-----ELLEREDRRESQQEI-LRRIAK-------DLPIYTRT--MSGAIR 124

  Fly   267 ICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLT 331
            .|:.|..:.|.|.:||..|..|:.:.|||..|:|.|:|..||.::::.||.|   ||....:|.|
Zfish   125 YCDRCLLLKPDRCHHCSACDMCILKMDHHCPWVNNCVGFANYKFFMLFLAYS---LLYCLFVTAT 186

  Fly   332 SICH--PFMVV------RPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAY 388
            .:.:  .|..|      |.:.|...|||..::    |.:...|..|.   ..|..:||:.|...:
Zfish   187 DMQYFIQFWTVDGKTHDRLIQYLNGLPDTQAK----FHIMFLFFAAS---TFSVSLAFLFAYHCW 244

  Fly   389 LWWKG-STLHEYKRTSNAAGRNR------IWSNWRAI 418
            |..|. |||..::..:...|.::      .:.|:|.:
Zfish   245 LVCKNRSTLEAFRAPAFQHGTDKNGFSLGAYKNFRQV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 44/145 (30%)
zdhhc2XP_021336686.1 zf-DHHC 11..305 CDD:327686 71/297 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.