DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC2

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_011542846.1 Gene:ZDHHC2 / 51201 HGNCID:18469 Length:412 Species:Homo sapiens


Alignment Length:148 Identity:39/148 - (26%)
Similarity:65/148 - (43%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 MHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLG 325
            |.|....|:.|:.:.|.|.:||.||..|:.:.|||..|:|.|:|..||.::::.||.|.:..|  
Human   167 MSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCL-- 229

  Fly   326 ANLTLTSICHPFMVVRPLGYPVL-----LPDDCSEVFEGFDLGISFVVACYALLISSYIAFILAR 385
                       |:....|.|.:.     |||..::....|   :.|..|.:::.:||...:    
Human   230 -----------FIAATDLQYFIKFWTNGLPDTQAKFHIMF---LFFAAAMFSVSLSSLFGY---- 276

  Fly   386 QAYLWW---KGSTLHEYK 400
              :.|.   ..|||..::
Human   277 --HCWLVSKNKSTLEAFR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/144 (26%)
ZDHHC2XP_011542846.1 zf-DHHC 172..293 CDD:279823 37/143 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.