DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc18

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:376 Identity:86/376 - (22%)
Similarity:120/376 - (31%) Gaps:132/376 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PWRGGAKRISPAA-----VAPAFIVPLMLG--------------------------------LAT 116
            |...||:|..|||     ..||...|...|                                ||.
Mouse    17 PASPGARRPGPAAPPAPSPGPAPGAPRWSGSGSGSGSLGRRPRRKWEVFPGRNRFYCGGRLMLAG 81

  Fly   117 LNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFLSWLVFSVFYMIIIFEFQVPLLELAPEENYA 181
            .....|:.|:|.|              :|...||    ||...|:.......:|::.       |
Mouse    82 HGGVFALTLLLIL--------------STTILFF----VFDCPYLARTLTLAIPIIA-------A 121

  Fly   182 LMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDD 246
            ::||  ..:.||.......|        |..|:   ..|.||::.|:|.                
Mouse   122 ILFF--FVMSCLLQTSFTDP--------GILPR---ATICEAAALEKQI---------------- 157

  Fly   247 DEVGDM----DTAERSGLMHGQP---NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIG 304
            |..|..    ....|..:::||.   ..|..|:...|.|..||.||..||:|.|||..|:..|:|
Mouse   158 DNTGSSTYRPPPRTREVMINGQTVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVG 222

  Fly   305 ERNY-VWYIVGLALSEIALLLGA----NLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGI 364
            .||| .:|...|:||.:...:.|    :|||.|....|:..        |....:.|.|      
Mouse   223 RRNYRFFYAFILSLSFLTAFIFACVVTHLTLLSQGSNFLSA--------LKKTPASVLE------ 273

  Fly   365 SFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRNRIWSNW 415
              :|.|:..:.|     ||....:        |.|...||......|..:|
Mouse   274 --LVICFFSIWS-----ILGLSGF--------HTYLVASNLTTNEDIKGSW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/144 (28%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.