DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc14

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:302 Identity:73/302 - (24%)
Similarity:116/302 - (38%) Gaps:84/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 RTNFFLSWLVF-----SVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSP-LNL 204
            |..||.:..:.     .|||:.:|       |.|....    :||   |..|.|.|:.::| :.:
  Rat    46 RNKFFCNGRIMMARQTGVFYLTLI-------LILVTSG----LFF---AFDCRYLAEKITPAIPV 96

  Fly   205 VSA-----QYGTTPKDEL--PGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSG--- 259
            |..     ..||..:...  ||:...::.:|.|:.:..:              |:.....||   
  Rat    97 VGGILFFFVMGTLLRTSFSDPGVLPRATPDEAADLERQI--------------DIANGTSSGGYR 147

  Fly   260 --------LMHGQP---NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNY-VWYI 312
                    :::||.   ..|..|:...|.||.||.:|..||::.|||..|:..|:|:||| .:|:
  Rat   148 PPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYM 212

  Fly   313 VGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISS 377
            ..|:||.:.:.:.| ..:|.:.|.   .:..|:...|.|..:.|.|        .|.|: ..:.|
  Rat   213 FILSLSFLTVFIFA-FVITHVIHR---SQQKGFLDALKDSPASVLE--------AVICF-FSVWS 264

  Fly   378 YIAFILARQAYLWWKGSTLHEYKRTSNAAGRNRI---WSNWR 416
            .|..            |..|.|..:||......|   |||.|
  Rat   265 IIGL------------SGFHTYLISSNQTTNEDIKGSWSNKR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 39/140 (28%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.