DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and CG17195

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:178 Identity:48/178 - (26%)
Similarity:77/178 - (43%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN---YVWYIVGLALSEIA-------- 321
            ||.|:|:...|::||.:|.||:.|||||..:...|||..|   :.|:...|.|..:.        
  Fly   105 CESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMF 169

  Fly   322 -LLLGAN-LTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLIS-SYI-AFI 382
             |..|.| ::|:|:... ::.|..             |:.: .|.:|....:.|.|| ||: ||:
  Fly   170 ILQNGGNFMSLSSVIFN-LITRTF-------------FQNY-TGNTFETIAFLLNISASYMPAFM 219

  Fly   383 LARQAYLWWKGSTLHEY----------KRTSNAAGRNRIWSNWRAILK 420
            ||.|..:..:.||.:..          |......|:..:|:....:||
  Fly   220 LAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFISPLLK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 43/145 (30%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 43/143 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467560
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.