DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and CG17197

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:273 Identity:55/273 - (20%)
Similarity:113/273 - (41%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELP 218
            :|.::|::::...:.||  :|...:.:........|::..|:...    |:::....:|..:.||
  Fly    32 IVTTIFFVVLQMFYVVP--QLFDVQGFMYKLGWLVAIFITYNIFG----NMLACHITSTSVESLP 90

  Fly   219 GIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCP 283
            ...:....||:                                | |.:.|::|.|:.|.|::||.
  Fly    91 KDRQIPEPEEE--------------------------------H-QWHYCDVCEKLMPPRSWHCI 122

  Fly   284 VCGTCVKRRDHHSYWLNCCIGERN---YVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGY 345
            :|..|:.:||.|..:...|:|..|   :.|:.:.:|       ||..:.|.:  |....::...|
  Fly   123 LCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMA-------LGTGVALAT--HIIATLKYFSY 178

  Fly   346 PVL----LPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAA 406
            ..|    :|.|   ....|.|.|:.::..|  :.::.::.:|.:.:.|...| |||::...:...
  Fly   179 SDLIFLNIPRD---NLPPFWLVITLILNTY--VFAAPVSSVLMQLSVLKNNG-TLHKFYSDTYDL 237

  Fly   407 GRNRIWSNWRAIL 419
            |   :|.|::.||
  Fly   238 G---LWENFKLIL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 37/143 (26%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/39 (15%)
zf-DHHC 100..>198 CDD:279823 30/142 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.