powered by:
Protein Alignment GABPI and zgc:77880
DIOPT Version :9
Sequence 1: | NP_608741.1 |
Gene: | GABPI / 33516 |
FlyBaseID: | FBgn0031495 |
Length: | 420 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_957185.1 |
Gene: | zgc:77880 / 393865 |
ZFINID: | ZDB-GENE-040426-1901 |
Length: | 297 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 27/66 - (40%) |
Similarity: | 39/66 - (59%) |
Gaps: | 6/66 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 ICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYI-----VGLA-LSEIALLLG 325
:|..|....|.||:||.||..|::|.|||..|:|.|:||.|..::| .|:| |..:||::.
Zfish 103 VCSRCETYRPPRAHHCRVCQRCIRRMDHHCPWINNCVGELNQKYFIQFLFYTGMASLYSMALVVS 167
Fly 326 A 326
|
Zfish 168 A 168
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.