DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and CG10344

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster


Alignment Length:271 Identity:55/271 - (20%)
Similarity:91/271 - (33%) Gaps:113/271 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFY-MIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPK 214
            |.:|:.:||. ::.:||..|.|........:...|....|::.:::.|.    |:::...     
  Fly    16 LCFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKG----NMIACMM----- 71

  Fly   215 DELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRA 279
                             ..|::.::.|....|    .::..|           |..|:|:.|.|:
  Fly    72 -----------------IDTSVNVKKVEPPSD----QLNWRE-----------CGECQKLAPPRS 104

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLG 344
            :||..|..|:.:||||..:..||||.||                           |.|       
  Fly   105 WHCKACKVCILKRDHHCIYTGCCIGLRN---------------------------HRF------- 135

  Fly   345 YPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRN 409
                        |.|| :...||.:.|||:.:|         .|:|    .:|           .
  Fly   136 ------------FMGF-IFYLFVGSVYALVYNS---------IYMW----VIH-----------G 163

  Fly   410 RIWSNWRAILK 420
            .|:|||..:||
  Fly   164 HIYSNWVTVLK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 33/136 (24%)
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 39/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467555
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.