DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and CG8314

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster


Alignment Length:279 Identity:68/279 - (24%)
Similarity:108/279 - (38%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKD 215
            ::||      :|:..||.|..|.|.| .||.:                .|.:|::..|       
  Fly    44 MTWL------LILFAEFVVMRLILLP-SNYTV----------------FSTINMIIFQ------- 78

  Fly   216 ELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEV----GDMDTAERSGLMHGQPNI-CEICRKVT 275
            .|..:|.||            .:.::|| |...|    ...:..|:.|...||... |..|..:.
  Fly    79 ALAFLAFAS------------HIRTMLS-DPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIK 130

  Fly   276 PRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN------YVWYIVGLALSEIALLLGANLTLTSIC 334
            |.||:||.||..|:::.|||..|:|.|:||.|      :.:||..:::..:.|:    ||..:.|
  Fly   131 PERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLV----LTQFAEC 191

  Fly   335 --HPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFI--------LARQAYL 389
              :.:....|...|..:.......|||...||..::    :|.:...|.:        |.::...
  Fly   192 VKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTII----MLATQLTAILNDQTGIEQLKKEEAR 252

  Fly   390 WWKGSTLHEYKRTSNAAGR 408
            |.|.|.|   |...:..||
  Fly   253 WAKKSRL---KSIQSVFGR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/153 (27%)
CG8314NP_611070.1 DHHC 122..249 CDD:396215 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.