DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and CG4676

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:191 Identity:43/191 - (22%)
Similarity:77/191 - (40%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 MDTAERSGLMHGQPNI----------CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGER 306
            :||:.|..|:  :|.:          |:.|:.:.|.|::||.||..||.:||||..:..||||..
  Fly    75 VDTSIRKELL--KPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHH 137

  Fly   307 NY---VWYIVGLALSEIALLLGANLTLTSICH---------PFMVVRPLGYPVLLPDDCSEVFEG 359
            ||   .:|:|.:.:..:|..:..::.|..: |         .|.:..|:...:|.|.     :|.
  Fly   138 NYRYFFYYLVYMIIGSLAAAIMESIYLWHL-HLDIYWRWSTLFTIFAPVVSLMLSPS-----WES 196

  Fly   360 FDLGI------SFVVACYALL-----------------------ISSYIAFILARQAYLWW 391
            |.|.|      .|.::...|:                       :...:..:|.::.:|.|
  Fly   197 FYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTW 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 39/181 (22%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467559
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.