DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and CG1407

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:286 Identity:58/286 - (20%)
Similarity:104/286 - (36%) Gaps:85/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KRTATRTNFFLS---WLVFSVFYMIIIFEFQVPLLELA--PEEN-----YALMFFSCAALYCLYS 195
            :|..|...|.::   |:.......:|.:.:...::||.  ..||     :.|:|:.......::|
  Fly     7 RRRKTPCGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWS 71

  Fly   196 --AKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERS 258
              ...::.:..:..|: ..|.:|:..:..|.|.:.|         :.:|   ::...|:....|:
  Fly    72 YWRTIMTSVGRIPDQW-RIPDEEVSRLFRADSPDTQ---------KRIL---NNFARDLPVTNRT 123

  Fly   259 GLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALL 323
              |:|....||.|:.:.|.||:||.||..||.:.|||..|:|.|:...||.:::         |.
  Fly   124 --MNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFV---------LF 177

  Fly   324 LGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAY 388
            ||                                             |||:...|:||.......
  Fly   178 LG---------------------------------------------YALVYCLYVAFTSLHDFV 197

  Fly   389 LWWK----GSTLHEYKRTSNAAGRNR 410
            .:||    .:..:..:...||:|..|
  Fly   198 EFWKVGAYDNNGYSAQGQLNASGMGR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 32/140 (23%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.