DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc8b

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_840089.2 Gene:zdhhc8b / 352941 ZFINID:ZDB-GENE-030407-3 Length:751 Species:Danio rerio


Alignment Length:314 Identity:66/314 - (21%)
Similarity:96/314 - (30%) Gaps:111/314 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 KRISPAAVAPAFIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFL---SWLVF 156
            ||..|....|.              .||..|   |||.|             |.||:   .||..
Zfish     7 KRFKPTKYIPV--------------STAATL---LVGST-------------TLFFVFTCPWLTK 41

  Fly   157 SVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIA 221
            :|..::.::...|.|..||   |:::..|             :.|        |..|:       
Zfish    42 AVSPVVPLYNGIVFLFVLA---NFSMATF-------------MDP--------GVFPR------- 75

  Fly   222 EASSGEEQAEAQTTLQMESVLSLDDDEVGDMD-------TAERSGLMHGQPNICEICRKVTPRRA 279
                                  .|:||..|.|       ..|..|: ..:...|..|....|.|.
Zfish    76 ----------------------ADEDEDKDDDFRAPLYKNVEIKGI-QVRMKWCATCHFYRPPRC 117

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLG 344
            .||.||..||:..|||..|:|.|||.|||.::.:.|....:.::...:..|..:.|..       
Zfish   118 SHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLSVHMVGVFSFGLLFMLHHL------- 175

  Fly   345 YPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHE 398
                      |........::.||.|...|....:..:......|..:|.|.:|
Zfish   176 ----------ETLSALHTTVTLVVMCVTGLFFIPVMGLTGFHMVLVARGRTTNE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 33/137 (24%)
zdhhc8bNP_840089.2 zf-DHHC 99..224 CDD:279823 33/139 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..346
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..461
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 633..659
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 666..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 703..736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.