DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc8

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:204 Identity:47/204 - (23%)
Similarity:84/204 - (41%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 PGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHC 282
            |||...:|.:|..|.:....:             ...||.:|:. .:...|..|:...|.|..||
  Fly    65 PGIIPKASPDEDCEEELRAPL-------------YKNAEINGIT-VKMKWCVTCKFYRPPRCSHC 115

  Fly   283 PVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPV 347
            .||..|::..|||..|:|.|||.|||.::...|....|.:     |::.|:|..:::       .
  Fly   116 SVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHM-----LSIFSLCLVYVL-------K 168

  Fly   348 LLPD--DCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHE-----YKRTSNA 405
            ::|:  |.:.:.....:|:..::|.....::.:...:::|       |.|.:|     :|...|.
  Fly   169 IMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSR-------GRTTNEQVTGKFKGGYNP 226

  Fly   406 AGRNRIWSN 414
            ..|. .|.|
  Fly   227 FSRG-CWHN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 33/143 (23%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.