DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc9

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:293 Identity:65/293 - (22%)
Similarity:114/293 - (38%) Gaps:90/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 FFLS-WLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTT 212
            |:|: :|:.....:...||.:...::|:|    |:..|  ||:..|:|...|         ..|:
  Rat    38 FYLTLFLILGTCTLFFAFECRYLAVQLSP----AIPVF--AAMLFLFSMATL---------LRTS 87

  Fly   213 PKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQ---PNI------- 267
            ..|  ||:...:..:|.|..:..::                 |....:..||   |.|       
  Rat    88 FSD--PGVIPRALPDEAAFIEMEIE-----------------ATNGAVPQGQRPPPRIKNFQINN 133

  Fly   268 -------CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNY-VWYIVGLALSEIALLL 324
                   |..|:...|.||.||.:|..||:|.|||..|:..|:|:||| .:|:..|:||.:.:.:
  Rat   134 QIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYV 198

  Fly   325 GANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALL-----ISSYIAFILA 384
            .|    .:|.:..:....:|:...|.:....|.|        |:.|:..|     ::.:..|::|
  Rat   199 FA----FNIVYVALKSLKIGFLETLKETPGTVLE--------VLICFFTLWSVVGLTGFHTFLVA 251

  Fly   385 RQAYLWWKGSTLHEYKRTSNA------AGRNRI 411
                          ..:|:|.      .|:||:
  Rat   252 --------------LNQTTNEDIKGSWTGKNRV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 39/159 (25%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 37/148 (25%)
ANXA2R <284..>343 CDD:292349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.