DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc3

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:281 Identity:63/281 - (22%)
Similarity:104/281 - (37%) Gaps:85/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 FYMIIIFEFQVPLLELAPEENYA----------LMFFSCAALYCLYSAKALSPLNLVSAQYGTTP 213
            :::::..||.|..:.|.|..:||          |:.|...|.:|  .|....|        |..|
  Rat    52 WFLVLYAEFVVLFVMLIPSRDYAYSIINGIVFNLLAFLALASHC--RAMLTDP--------GAVP 106

  Fly   214 KDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNI-CEICRKVTPR 277
            |           |....|...:||::.                      ||... |..|..:.|.
  Rat   107 K-----------GNATKEFIESLQLKP----------------------GQVVYKCPKCCSIKPD 138

  Fly   278 RAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRP 342
            ||:||.||..|:::.|||..|:|.|:||.|..:::          |....:.|.|: |..::|  
  Rat   139 RAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFV----------LFTMYIALISL-HALIMV-- 190

  Fly   343 LGYPVL--LPDD---CSEVFEGFDLGISFVVACY-ALLISSYIAFILARQAYLWWKGST----LH 397
             |:..|  ..:|   ||. |......|..::.|: |||...:.:.:...|.:......|    |.
  Rat   191 -GFHFLHCFEEDWTKCSS-FSPPTTVILLILLCFEALLFLIFTSVMFGTQVHSICTDETGIERLQ 253

  Fly   398 EYKRTSNAAGRNRIWSNWRAI 418
            ..|:....:|      :|:::
  Rat   254 RSKQPREQSG------SWKSV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 40/147 (27%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.