DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc22

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:270 Identity:67/270 - (24%)
Similarity:96/270 - (35%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 FYMIIIFEFQVPLLELAP---EENYALMFFSCA----ALYCLYSAKALSPLNLVSAQYGTTPKDE 216
            |..|.:..|.:.|....|   |:..|...||.|    ||:...||.||....||   ...:| |:
  Rat    15 FLCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALFLFLSANALGNYILV---VQNSP-DD 75

  Fly   217 LPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYH 281
            |......||...|....:|                              :.|.:|.:||      
  Rat    76 LGACQGTSSQRPQRPPPST------------------------------HFCRVCARVT------ 104

  Fly   282 CPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALL--LGANLTLTSICHPFMVVRPLG 344
                    .|.|||.::...|||.||...:|:....:.:|.|  :.|.:...|.........||.
  Rat   105 --------LRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLA 161

  Fly   345 YPVLLPDDCSEVFEGFDLGIS-FVVACYALLISSYIAFILA------RQAYLWWKGSTLHEYKRT 402
            :..|||...|:.|.|..||.. ||:    |::..:.|..||      .|..|..:|.|.::.:: 
  Rat   162 FLTLLPTSISQFFSGAVLGSDMFVI----LMLYLWFAVGLACAGFCCHQLLLILRGQTRYQVRK- 221

  Fly   403 SNAAGRNRIW 412
             ..|.|.|.|
  Rat   222 -GVAVRARPW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/145 (26%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.