DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc21

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001034098.1 Gene:Zdhhc21 / 298184 RGDID:1305750 Length:265 Species:Rattus norvegicus


Alignment Length:255 Identity:58/255 - (22%)
Similarity:92/255 - (36%) Gaps:94/255 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LVFSVFYMIIIFEFQVPLLELAP--EENY----ALMFFSCAALYCLYSAKALSPLNLVSAQYGTT 212
            :||...|.|:|    :|.:.|.|  ||.:    .::.|...:::||.:        ||.|  ..|
  Rat    20 IVFVWLYNIVI----IPKIVLFPHYEEGHIPGILIIIFYGISIFCLVA--------LVRA--SLT 70

  Fly   213 PKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRK---V 274
            ....||                                     |...:.|.:..:.|:|.|   :
  Rat    71 DPGRLP-------------------------------------ENPKIPHAERELWELCNKCNLM 98

  Fly   275 TPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLA-----LSEIALLLG--------- 325
            .|:|::||..||.||:|.|||..|:|.|:||.|: |..:.|.     |:..||:..         
  Rat    99 RPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNH-WLFLQLCFYTELLTCYALMFSFCHYYYFLP 162

  Fly   326 ---ANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFI 382
               .||.|..:.|...::|...:                :||:.:|....|..:..|..|
  Rat   163 LKTRNLDLFVVRHELAIMRLAAF----------------MGITMLVGITGLFYTQLIGII 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/141 (27%)
Zdhhc21NP_001034098.1 DHHC 92..217 CDD:396215 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D519878at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.