DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC8

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens


Alignment Length:236 Identity:53/236 - (22%)
Similarity:79/236 - (33%) Gaps:77/236 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RGGAKRISPAAVAP-AFIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFLSWL 154
            |....|:.||...| |....|::|.:||              |.:              |...||
Human     3 RSPGTRLKPAKYIPVATAAALLVGSSTL--------------FFV--------------FTCPWL 39

  Fly   155 VFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPG 219
            ..:|...:.::...:.|..||   |:::..|..                              ||
Human    40 TRAVSPAVPVYNGIIFLFVLA---NFSMATFMD------------------------------PG 71

  Fly   220 IAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPV 284
            :...:..:|..|             ||.........:..|: ..:...|..|....|.|..||.|
Human    72 VFPRADEDEDKE-------------DDFRAPLYKNVDVRGI-QVRMKWCATCHFYRPPRCSHCSV 122

  Fly   285 CGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLG 325
            |..||:..|||..|:|.|||.|||.::.:.| ||..|.::|
Human   123 CDNCVEDFDHHCPWVNNCIGRRNYRYFFLFL-LSLSAHMVG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 26/64 (41%)
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:366691 26/66 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.