DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC1

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens


Alignment Length:268 Identity:62/268 - (23%)
Similarity:104/268 - (38%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKD 215
            ::||:: :|:.:|.|...||||    ..::....::|  :..:::...:..|..||.        
Human    54 VAWLLY-LFFAVIGFGILVPLL----PHHWVPAGYAC--MGAIFAGHLVVHLTAVSI-------- 103

  Fly   216 ELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNI-CEICRKVTPRRA 279
                        :.|:|...         |....|.:....||...|...:: |.:|......|:
Human   104 ------------DPADANVR---------DKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARS 147

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFM--VVRP 342
            .||..|..||...|||..|||.|:|||||..::..:|    :.|||..|.:....:.|:  .|.|
Human   148 KHCSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVA----SALLGVLLLVLVATYVFVEFFVNP 208

  Fly   343 LG----------------YPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWW 391
            :.                :.|.||....|......|.::.::....||.::.:..:|....||.|
Human   209 MRLRTNRHFEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLSTALLGHLLCFHIYLMW 273

  Fly   392 KGSTLHEY 399
            ...|.:||
Human   274 HKLTTYEY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/155 (26%)
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 56/256 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
zf-DHHC 129..284 CDD:307600 43/157 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.