DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc24

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001034189.1 Gene:Zdhhc24 / 293665 RGDID:1565630 Length:284 Species:Rattus norvegicus


Alignment Length:212 Identity:47/212 - (22%)
Similarity:68/212 - (32%) Gaps:73/212 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 QTTLQMESVLSLDDDEVGDMDTAERS------------GLMHGQPNICEICRKVTPRRAYHCPVC 285
            |..|....:|:|    :|:|....||            ||..|.. .|..|:...|.|:.||..|
  Rat    54 QLALAAYQLLNL----LGNMGLFLRSDPSIRGVMLAGRGLGQGWA-YCYQCQSQVPPRSGHCSAC 113

  Fly   286 GTCVKRRDHHSYWLNCCIGERNY---------------------------------VWYIVGLAL 317
            ..|:.|||||...|..|:|..||                                 ..|.|.|.|
  Rat   114 RVCILRRDHHCRLLGRCVGFHNYRPFLCLLLHAAGVLLHISVLLSPALSALLQAHSALYTVALLL 178

  Fly   318 SEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFI 382
            ....:||...::|......|:|           |.|          ::..:.|.|.|:...:..:
  Rat   179 LPWLMLLTGKVSLAQFALAFVV-----------DTC----------VAGALLCGAGLLFHGMLLL 222

  Fly   383 LARQAYLWWKGSTLHEY 399
            ..:..:.|.:|.  |.|
  Rat   223 RGQTTWEWARGQ--HSY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 36/169 (21%)
Zdhhc24NP_001034189.1 zf-DHHC 95..234 CDD:279823 33/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.