DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc1

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:268 Identity:62/268 - (23%)
Similarity:104/268 - (38%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKD 215
            ::||:: :|:.:|.|...||||    ..::....::|  :..:::...:..|..||.        
  Rat    51 VAWLLY-LFFAVIGFGVLVPLL----PHHWVPAGYAC--MGAIFAGHLVVHLTAVSI-------- 100

  Fly   216 ELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNI-CEICRKVTPRRA 279
                        :.|:|...         |....|.:....||...|...:: |.:|......|:
  Rat   101 ------------DPADANVR---------DKSYSGPLPIFNRSQHAHVIEDLHCNLCDVDVSARS 144

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFM--VVRP 342
            .||..|..||...|||..|||.|:|||||..::..:|    :.|||..|.:....:.|:  .|.|
  Rat   145 KHCSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVA----SALLGVLLLVLVATYVFVEFFVNP 205

  Fly   343 LG----------------YPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWW 391
            :.                :.|.||....|......|.::.::....||.::.:..:|....||.|
  Rat   206 MRLRTNQHFEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLSTALLGHLLCFHIYLMW 270

  Fly   392 KGSTLHEY 399
            ...|.:||
  Rat   271 HKLTTYEY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/155 (26%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 43/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.