DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and AT2G14255

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_973453.2 Gene:AT2G14255 / 2745525 AraportID:AT2G14255 Length:536 Species:Arabidopsis thaliana


Alignment Length:301 Identity:72/301 - (23%)
Similarity:127/301 - (42%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LAKRTATRTNFFL-------------SWLVFS-VFYMIIIFEFQVPLLELAPEENYALMFFSCAA 189
            |:|...||.|.|:             :.::|| :..::::|...:......|:....:..::|..
plant   245 LSKAMRTRKNSFVDKIFCGKLGETSYAPMLFSLIVILMVLFITSIVSASNLPKITAMVGLWACFG 309

  Fly   190 LYC-LYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMD 253
            |.| :|:        |::. |..:.||  ||..:.:.   :|.:|.|.         :|.:.|::
plant   310 LSCGVYA--------LITF-YRVSRKD--PGYVKRTG---EANSQHTA---------NDPLIDIN 351

  Fly   254 TAERSGLMHGQ-PNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLAL 317
            ....|  ..|. ..:|..|:.:.|.|:.|||.|..||::.|||..|::.|:|::|..:::|    
plant   352 FKNPS--WKGNWSQLCPTCKIIRPVRSKHCPTCKRCVEQFDHHCPWISNCVGKKNKRYFLV---- 410

  Fly   318 SEIALLLGANLTLTSICHPFMVVRPL--GYP-----------VLLPDDCSEVFEGFDLGISFVVA 369
               .:::||   |||.......|:.|  |.|           :::....:.||..|||.|  .:|
plant   411 ---FVIMGA---LTSFVGGTTAVQRLWRGIPQVHHGESWIKHIVIEHPDAAVFLFFDLLI--FIA 467

  Fly   370 CYALLISSYIAFILARQAYLWWKGSTLHEY---KRTSNAAG 407
            ...|.||         |:|:..:..|.:|.   ||.|...|
plant   468 TMTLTIS---------QSYMIARNITTNELWNAKRFSYLRG 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/150 (27%)
AT2G14255NP_973453.2 Ank_4 28..78 CDD:290365
ANK repeat 57..88 CDD:293786
ANK 57..85 CDD:197603
Ank_2 62..188 CDD:289560
ANK 85..211 CDD:238125
ANK repeat 92..155 CDD:293786
Ank_5 110..165 CDD:290568
ANK repeat 157..188 CDD:293786
Ank_5 176..233 CDD:290568
ANK repeat 190..214 CDD:293786
ANK repeat 225..254 CDD:293786 4/8 (50%)
zf-DHHC 363..492 CDD:279823 41/149 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.